AS3MT anticorps

N° du produit ABIN633047

Détail du produit anti-AS3MT anticorps

Antigène: AS3MT (Arsenic (+3 Oxidation State) Methyltransferase (AS3MT))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AS3MT est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: AS3 MT antibody was raised using a synthetic peptide corresponding to a region with amino acids GIKNESHDIVVSNCVINLVPDKQQVLQEAYRVLKHGGELYFSDVYTSLEL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

AS3MT Blocking Peptide, catalog no. 33R-3331, is also available for use as a blocking control in assays to test for specificity of this AS3MT antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AS0 T antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur AS3MT

Antigène: AS3MT (Arsenic (+3 Oxidation State) Methyltransferase (AS3MT))

Autre désignation: AS3MT (AS3MT Produits)

Synonymes: anticorps CYT19, anticorps 2310045H08Rik, anticorps Cyt19, anticorps AS3MT, anticorps zgc:136933, anticorps DKFZp469A1918, anticorps cyt19, anticorps arsenite methyltransferase, anticorps arsenic (+3 oxidation state) methyltransferase, anticorps BLOC-1 related complex subunit 7, anticorps arsenite methyltransferase, gene 1, anticorps AS3MT, anticorps As3mt, anticorps as3mt, anticorps BORCS7, anticorps as3mt.1, anticorps ABO_2182

Sujet: AS3MT catalyzes the transfer of a methyl group from S-adenosyl-L-methionine (AdoMet) to trivalent arsenical and may play a role in arsenic metabolism.

Poids moléculaire: 42 kDa (MW of target protein)