ITLN2 anticorps (Middle Region)
-
- Antigène Voir toutes ITLN2 Anticorps
- ITLN2 (Intelectin 2 (ITLN2))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ITLN2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ITLN2 antibody was raised against the middle region of ITLN2
- Purification
- Affinity purified
- Immunogène
- ITLN2 antibody was raised using the middle region of ITLN2 corresponding to a region with amino acids TVGDRWSSQQGNKADYPEGDGNWANYNTFGSAEAATSDDYKNPGYYDIQA
- Top Product
- Discover our top product ITLN2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ITLN2 Blocking Peptide, catalog no. 33R-9353, is also available for use as a blocking control in assays to test for specificity of this ITLN2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ITLN2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ITLN2 (Intelectin 2 (ITLN2))
- Autre désignation
- ITLN2 (ITLN2 Produits)
- Synonymes
- anticorps HL2, anticorps HL-2, anticorps hl2, anticorps hl-2, anticorps MGC80711, anticorps itln1, anticorps MGC186157, anticorps itln3, anticorps intelectin 2, anticorps intelectin 2 L homeolog, anticorps ITLN2, anticorps itln2.L, anticorps itln2
- Sujet
- ITLN2 may play a role in the defense system against pathogens.
- Poids moléculaire
- 36 kDa (MW of target protein)
-