TUBG2 anticorps (Middle Region)

N° du produit ABIN633086

Détail du produit anti-TUBG2 anticorps

Antigène: TUBG2 (Tubulin, gamma 2 (TUBG2))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TUBG2 est non-conjugé

Application: Western Blotting (WB)

Specificité: Gamma Tubulin 2 antibody was raised against the middle region of TUBG2

Purification: Affinity purified

Immunogène: Gamma Tubulin 2 antibody was raised using the middle region of TUBG2 corresponding to a region with amino acids FDKLRKRDAFLEQFRKEDMFKDNFDEMDRSREVVQELIDEYHAATQPDYI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Gamma Tubulin 2 Blocking Peptide, catalog no. 33R-2866, is also available for use as a blocking control in assays to test for specificity of this Gamma Tubulin 2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TUBG2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TUBG2

Antigène: TUBG2 (Tubulin, gamma 2 (TUBG2))

Abstract: TUBG2 Produits

Synonymes: anticorps ARABIDOPSIS THALIANA GAMMA-TUBULIN COMPLEX PROTEIN 2, anticorps ATGCP2, anticorps GAMMA-TUBULIN 2, anticorps MJJ3.10, anticorps MJJ3_10, anticorps TUBG2, anticorps gamma-tubulin complex protein 2, anticorps AI504772, anticorps Tubgl, anticorps gamma-tubulin, anticorps gamma-tubulin complex protein 2, anticorps tubulin gamma 2, anticorps tubulin, gamma 2, anticorps TUBG2, anticorps GCP2, anticorps Tubg2

Sujet: Tubulin is the major constituent of microtubules. Gamma tubulin is found at microtubule organizing centers (MTOC) such as the spindle poles or the centrosome, suggesting that it is involved in the minus-end nucleation of microtubule assembly.

Poids moléculaire: 51 kDa (MW of target protein)

Pathways: Dynamique des Microtubules, M Phase