FTO anticorps (Middle Region)

N° du produit ABIN633096

Détail du produit anti-FTO anticorps

Antigène: FTO (Fat Mass and Obesity-Associated (FTO))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FTO est non-conjugé

Application: Western Blotting (WB)

Specificité: FTO antibody was raised against the middle region of FTO

Purification: Affinity purified

Immunogène: FTO antibody was raised using the middle region of FTO corresponding to a region with amino acids WWCQPMAQLEALWKKMEGVTNAVLHEVKREGLPVEQRNEILTAILASLTA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FTO Blocking Peptide, catalog no. 33R-10037, is also available for use as a blocking control in assays to test for specificity of this FTO antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FTO antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FTO

Antigène: FTO (Fat Mass and Obesity-Associated (FTO))

Autre désignation: FTO (FTO Produits)

Synonymes: anticorps AW743446, anticorps mKIAA1752, anticorps RGD1305121, anticorps FTO, alpha-ketoglutarate dependent dioxygenase, anticorps fat mass and obesity associated, anticorps fat mass and obesity associated L homeolog, anticorps FTO, anticorps Fto, anticorps fto.L

Sujet: The exact function of this gene is not known. Studies in mice suggest that it may be involved in nucleic acid demethylation, and that its mRNA level is regulated by feeding and fasting. Genomewide association studies of type 2 diabetes indicate this gene as a diabetes susceptibility locus. Mutation in this gene has been associated with growth retardation, developmental delay, coarse facies, and early death.

Poids moléculaire: 58 kDa (MW of target protein)