NAP1L2 anticorps (Middle Region)

N° du produit ABIN633097

Détail du produit anti-NAP1L2 anticorps

Antigène: NAP1L2 (Nucleosome Assembly Protein 1-Like 2 (NAP1L2))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NAP1L2 est non-conjugé

Application: Western Blotting (WB)

Specificité: NAP1 L2 antibody was raised against the middle region of NAP1 2

Purification: Affinity purified

Immunogène: NAP1 L2 antibody was raised using the middle region of NAP1 2 corresponding to a region with amino acids VDTLTPLIKKYDEPILKLLTDIKVKLSDPGEPLSFTLEFHFKPNEYFKNE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NAP1L2 Blocking Peptide, catalog no. 33R-9481, is also available for use as a blocking control in assays to test for specificity of this NAP1L2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NAP0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NAP1L2

Antigène: NAP1L2 (Nucleosome Assembly Protein 1-Like 2 (NAP1L2))

Autre désignation: NAP1L2 (NAP1L2 Produits)

Synonymes: anticorps BPX, anticorps Bpx, anticorps nucleosome assembly protein 1 like 2, anticorps nucleosome assembly protein 1-like 2, anticorps NAP1L2, anticorps Nap1l2

Sujet: This gene encodes a member of the nucleosome assembly protein (NAP) family. The function of this family member is unknown, however, mouse studies suggest that it represents a class of tissue-specific factors interacting with chromatin to regulate neuronal cell proliferation.

Poids moléculaire: 52 kDa (MW of target protein)