STK38L anticorps (Middle Region)

N° du produit ABIN633103

Détail du produit anti-STK38L anticorps

Antigène: STK38L (serine/threonine Kinase 38 Like (STK38L))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp STK38L est non-conjugé

Application: Western Blotting (WB)

Specificité: STK38 L antibody was raised against the middle region of STK38

Purification: Affinity purified

Immunogène: STK38 L antibody was raised using the middle region of STK38 corresponding to a region with amino acids PAAIPIEIKSIDDTSNFDDFPESDILQPVPNTTEPDYKSKDWVFLNYTYK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

STK38L Blocking Peptide, catalog no. 33R-6952, is also available for use as a blocking control in assays to test for specificity of this STK38L antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STK30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur STK38L

Antigène: STK38L (serine/threonine Kinase 38 Like (STK38L))

Autre désignation: STK38L (STK38L Produits)

Synonymes: anticorps RGD1564793, anticorps NDR2, anticorps 4930473A22Rik, anticorps B230328I19, anticorps Ndr2, anticorps Ndr54, anticorps serine/threonine kinase 38 like, anticorps Stk38l, anticorps STK38L

Sujet: STK38L is involved in the regulation of structural processes in differentiating and mature neuronal cells.

Poids moléculaire: 54 kDa (MW of target protein)