RHOJ anticorps (Middle Region)

N° du produit ABIN633105

Détail du produit anti-RHOJ anticorps

Antigène: RHOJ (Ras Homolog Gene Family, Member J (RHOJ))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RHOJ est non-conjugé

Application: Western Blotting (WB)

Specificité: RHOJ antibody was raised against the middle region of RHOJ

Purification: Affinity purified

Immunogène: RHOJ antibody was raised using the middle region of RHOJ corresponding to a region with amino acids LGLYDTAGQEDYNQLRPLSYPNTDVFLICFSVVNPASYHNVQEEWVPELK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RHOJ Blocking Peptide, catalog no. 33R-4988, is also available for use as a blocking control in assays to test for specificity of this RHOJ antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHOJ antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RHOJ

Antigène: RHOJ (Ras Homolog Gene Family, Member J (RHOJ))

Autre désignation: RHOJ (RHOJ Produits)

Synonymes: anticorps MGC83410, anticorps RHOJ, anticorps si:dkey-100h21.1, anticorps arhj, anticorps rasl7b, anticorps tc10b, anticorps ARHJ, anticorps RASL7B, anticorps TC10B, anticorps TCL, anticorps 1110005O19Rik, anticorps AW210585, anticorps Arhj, anticorps TC10L, anticorps ras homolog family member J, anticorps ras homolog family member J L homeolog, anticorps RHOJ, anticorps rhoj.L, anticorps rhoj, anticorps Rhoj

Sujet: ARHJ belongs to the Rho family of small GTP-binding proteins. Rho proteins regulate the dynamic assembly of cytoskeletal components for several physiologic processes, such as cell proliferation and motility and the establishment of cell polarity. They are also involved in pathophysiologic process, such as cell transformation and metastasis.

Poids moléculaire: 24 kDa (MW of target protein)