PRSS8 anticorps (Middle Region)

N° du produit ABIN633110

Détail du produit anti-PRSS8 anticorps

Antigène: PRSS8 (Protease, serine, 8 (PRSS8))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PRSS8 est non-conjugé

Application: Western Blotting (WB)

Specificité: PRSS8 antibody was raised against the middle region of PRSS8

Purification: Affinity purified

Immunogène: PRSS8 antibody was raised using the middle region of PRSS8 corresponding to a region with amino acids PITFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PRSS8 Blocking Peptide, catalog no. 33R-7163, is also available for use as a blocking control in assays to test for specificity of this PRSS8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRSS8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PRSS8

Antigène: PRSS8 (Protease, serine, 8 (PRSS8))

Autre désignation: PRSS8 (PRSS8 Produits)

Synonymes: anticorps CAP1, anticorps PROSTASIN, anticorps prostasin, anticorps 2410039E18Rik, anticorps AI313909, anticorps C79772, anticorps fr, anticorps mCAP1, anticorps protease, serine 8, anticorps protease, serine, 8, anticorps protease, serine 8 (prostasin), anticorps PRSS8, anticorps Prss8

Sujet: This gene encodes a trypsinogen, which is a member of the trypsin family of serine proteases. This enzyme is highly expressed in prostate epithelia and is one of several proteolytic enzymes found in seminal fluid. The proprotein is cleaved to produce a light chain and a heavy chain which are associated by a disulfide bond. It is active on peptide linkages involving the carboxyl group of lysine or arginine.

Poids moléculaire: 33 kDa (MW of target protein)