UBXN10 anticorps (Middle Region)
-
- Antigène Voir toutes UBXN10 Anticorps
- UBXN10 (UBX Domain Protein 10 (UBXN10))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp UBXN10 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- UBXD3 antibody was raised against the middle region of UBXD3
- Purification
- Affinity purified
- Immunogène
- UBXD3 antibody was raised using the middle region of UBXD3 corresponding to a region with amino acids PYELPSSQKPGACAPKSPNQGASDEIPELQQQVPTGASSSLNKYPVLPSI
- Top Product
- Discover our top product UBXN10 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
UBXD3 Blocking Peptide, catalog no. 33R-7443, is also available for use as a blocking control in assays to test for specificity of this UBXD3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBXD3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- UBXN10 (UBX Domain Protein 10 (UBXN10))
- Autre désignation
- UBXD3 (UBXN10 Produits)
- Synonymes
- anticorps UBXD3, anticorps zgc:153648, anticorps 5730509E04Rik, anticorps A830047D02, anticorps Ubxd3, anticorps UBX domain protein 10, anticorps UBX domain protein 10 L homeolog, anticorps UBXN10, anticorps ubxn10, anticorps ubxn10.L, anticorps Ubxn10
- Sujet
- The function of UBXD3 protein is not widely studied, and is yet to be elucidated fully.
- Poids moléculaire
- 31 kDa (MW of target protein)
-