UBXN10 anticorps (Middle Region)

N° du produit ABIN633121

Détail du produit anti-UBXN10 anticorps

Antigène: UBXN10 (UBX Domain Protein 10 (UBXN10))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UBXN10 est non-conjugé

Application: Western Blotting (WB)

Specificité: UBXD3 antibody was raised against the middle region of UBXD3

Purification: Affinity purified

Immunogène: UBXD3 antibody was raised using the middle region of UBXD3 corresponding to a region with amino acids PYELPSSQKPGACAPKSPNQGASDEIPELQQQVPTGASSSLNKYPVLPSI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UBXD3 Blocking Peptide, catalog no. 33R-7443, is also available for use as a blocking control in assays to test for specificity of this UBXD3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBXD3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UBXN10

Antigène: UBXN10 (UBX Domain Protein 10 (UBXN10))

Autre désignation: UBXD3 (UBXN10 Produits)

Synonymes: anticorps UBXD3, anticorps zgc:153648, anticorps 5730509E04Rik, anticorps A830047D02, anticorps Ubxd3, anticorps UBX domain protein 10, anticorps UBX domain protein 10 L homeolog, anticorps UBXN10, anticorps ubxn10, anticorps ubxn10.L, anticorps Ubxn10

Sujet: The function of UBXD3 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 31 kDa (MW of target protein)