ASZ1 anticorps (Middle Region)
-
- Antigène Voir toutes ASZ1 Anticorps
- ASZ1 (Ankyrin Repeat, SAM and Basic Leucine Zipper Domain Containing 1 (ASZ1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ASZ1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ASZ1 antibody was raised against the middle region of ASZ1
- Purification
- Affinity purified
- Immunogène
- ASZ1 antibody was raised using the middle region of ASZ1 corresponding to a region with amino acids GKMPSEIAKRNKHHEIFNLLSFTLNPLEGKLQQLTKEDTICKILTTDSDR
- Top Product
- Discover our top product ASZ1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ASZ1 Blocking Peptide, catalog no. 33R-3373, is also available for use as a blocking control in assays to test for specificity of this ASZ1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASZ1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ASZ1 (Ankyrin Repeat, SAM and Basic Leucine Zipper Domain Containing 1 (ASZ1))
- Autre désignation
- ASZ1 (ASZ1 Produits)
- Synonymes
- anticorps Gasz, anticorps GASZ, anticorps gasz, anticorps MGC56332, anticorps zgc:56332, anticorps ALP1, anticorps ANKL1, anticorps C7orf7, anticorps CT1.19, anticorps Orf3, anticorps 4933400N19Rik, anticorps ORF3, anticorps ankyrin repeat, SAM and basic leucine zipper domain containing 1, anticorps Asz1, anticorps ASZ1, anticorps asz1
- Sujet
- ASZ1 plays a central role during spermatogenesis by repressing transposable elements and prevent their mobilization, which is essential for the germline integrity.
- Poids moléculaire
- 53 kDa (MW of target protein)
-