NOG anticorps (Middle Region)

N° du produit ABIN633158

L’anticorps anti-NOG Polyclonal Lapin est utilisé pour la détection de NOG dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour NOG anticorps (Middle Region) (ABIN633158)

Antigène: NOG (Noggin (NOG))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NOG est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-NOG anticorps

Épitope: Middle Region

Specificité: Noggin antibody was raised against the middle region of NOG

Purification: Affinity purified

Immunogène: Noggin antibody was raised using the middle region of NOG corresponding to a region with amino acids GGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Noggin Blocking Peptide, (ABIN938672), is also available for use as a blocking control in assays to test for specificity of this Noggin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NOG

Antigène: NOG (Noggin (NOG))

Autre désignation: Noggin

Sujet: The secreted polypeptide, encoded by this gene, binds and inactivates members of the transforming growth factor-beta (TGF-beta) superfamily signaling proteins, such as bone morphogenetic protein-4 (BMP4). By diffusing through extracellular matrices more efficiently than members of the TGF-beta superfamily, this protein may have a principal role in creating morphogenic gradients.

Poids moléculaire: 24 kDa (MW of target protein)

Pathways: Stem Cell Maintenance, Tube Formation