NOG anticorps (Middle Region)
-
- Antigène Voir toutes NOG Anticorps
- NOG (Noggin (NOG))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NOG est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Noggin antibody was raised against the middle region of NOG
- Purification
- Affinity purified
- Immunogène
- Noggin antibody was raised using the middle region of NOG corresponding to a region with amino acids GGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEI
- Top Product
- Discover our top product NOG Anticorps primaire
-
anti-Noggin (NOG) (AA 28-232) antibody
NOG Reactivité: Humain, Chien WB, IHC, IF, IHC (p) Hôte: Souris Monoclonal 4C12 unconjugated
anti-Noggin (NOG) (AA 28-232) antibodyNOG Reactivité: Humain WB, IHC, IP, ICC Hôte: Souris Monoclonal A7 unconjugated
anti-Noggin (NOG) (AA 28-232) antibodyNOG Reactivité: Humain WB, IHC, IP, ICC Hôte: Lapin Polyclonal unconjugated
anti-Noggin (NOG) (AA 1-232) antibodyNOG Reactivité: Humain WB, IP Hôte: Lapin Polyclonal unconjugated
anti-Noggin (NOG) (AA 28-130) antibodyNOG Reactivité: Souris, Rat WB, ELISA, FACS, IF (cc), IF (p), IHC (p), IHC (fro) Hôte: Lapin Polyclonal unconjugated
anti-Noggin (NOG) (AA 28-232) antibodyNOG Reactivité: Humain IHC, ELISA Hôte: Lapin Polyclonal unconjugated
anti-Noggin (NOG) (AA 84-111) antibodyNOG Reactivité: Humain, Souris WB Hôte: Lapin Polyclonal RB21954 unconjugated
anti-Noggin (NOG) antibodyNOG Reactivité: Humain, Souris IHC, ELISA Hôte: Lapin Polyclonal unconjugated
anti-Noggin (NOG) (AA 21-70) antibodyNOG Reactivité: Humain IHC, ELISA Hôte: Lapin Polyclonal unconjugated
anti-Noggin (NOG) antibodyNOG Reactivité: Souris, Rat WB Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Noggin Blocking Peptide, catalog no. 33R-3286, is also available for use as a blocking control in assays to test for specificity of this Noggin antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOG antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NOG (Noggin (NOG))
- Autre désignation
- Noggin (NOG Produits)
- Synonymes
- anticorps SYM1, anticorps SYNS1, anticorps nog-A, anticorps nog1, anticorps noggin-1, anticorps noggin, anticorps noggin, anticorps noggin L homeolog, anticorps noggin protein, anticorps NOG, anticorps Nog, anticorps nog.L, anticorps noggin
- Sujet
- The secreted polypeptide, encoded by this gene, binds and inactivates members of the transforming growth factor-beta (TGF-beta) superfamily signaling proteins, such as bone morphogenetic protein-4 (BMP4). By diffusing through extracellular matrices more efficiently than members of the TGF-beta superfamily, this protein may have a principal role in creating morphogenic gradients.
- Poids moléculaire
- 24 kDa (MW of target protein)
- Pathways
- Stem Cell Maintenance, Tube Formation
-
