ANGPTL3 anticorps (N-Term)

N° du produit ABIN633180

Détail du produit anti-ANGPTL3 anticorps

Antigène: ANGPTL3 (Angiopoietin-Like 3 (ANGPTL3))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ANGPTL3 est non-conjugé

Application: Western Blotting (WB)

Specificité: ANGPTL3 antibody was raised against the N terminal of ANGPTL3

Purification: Affinity purified

Immunogène: ANGPTL3 antibody was raised using the N terminal of ANGPTL3 corresponding to a region with amino acids IFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLEL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ANGPTL3 Blocking Peptide, catalog no. 33R-3960, is also available for use as a blocking control in assays to test for specificity of this ANGPTL3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANGPTL3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ANGPTL3

Antigène: ANGPTL3 (Angiopoietin-Like 3 (ANGPTL3))

Autre désignation: ANGPTL3 (ANGPTL3 Produits)

Synonymes: anticorps fb60e11, anticorps fb66h02, anticorps wu:fb60e11, anticorps wu:fb66h02, anticorps zgc:111943, anticorps ANGPTL3, anticorps LOC100230785, anticorps ANG-5, anticorps ANGPT5, anticorps ANL3, anticorps FHBL2, anticorps hypl, anticorps angiopoietin-like 3, anticorps angiopoietin like 3, anticorps angptl3, anticorps ANGPTL3, anticorps Angptl3

Sujet: The protein encoded by this gene is a member of the angiopoietin-like family of secreted factors.

Poids moléculaire: 51 kDa (MW of target protein)