ZCCHC17 anticorps (Middle Region)
-
- Antigène Voir toutes ZCCHC17 Anticorps
- ZCCHC17 (Zinc Finger, CCHC Domain Containing 17 (ZCCHC17))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ZCCHC17 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ZCCHC17 antibody was raised against the middle region of ZCCHC17
- Purification
- Affinity purified
- Immunogène
- ZCCHC17 antibody was raised using the middle region of ZCCHC17 corresponding to a region with amino acids CFMQPGGTKYSLIPDEEEEKEEAKSAEFEKPDPTRNPSRKRKKEKKKKKH
- Top Product
- Discover our top product ZCCHC17 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ZCCHC17 Blocking Peptide, catalog no. 33R-1685, is also available for use as a blocking control in assays to test for specificity of this ZCCHC17 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZCCHC17 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ZCCHC17 (Zinc Finger, CCHC Domain Containing 17 (ZCCHC17))
- Autre désignation
- ZCCHC17 (ZCCHC17 Produits)
- Synonymes
- anticorps HSPC251, anticorps PS1D, anticorps RP11-266K22.1, anticorps pNO40, anticorps ps1d, anticorps zgc:65790, anticorps zgc:85656, anticorps RGD1565267, anticorps pno40, anticorps hspc251, anticorps 2810055E05Rik, anticorps LDC4, anticorps pS1D, anticorps DKFZp459G2227, anticorps zinc finger CCHC-type containing 17, anticorps zinc finger, CCHC domain containing 17, anticorps zinc finger CCHC-type containing 17 L homeolog, anticorps ZCCHC17, anticorps zcchc17, anticorps zcchc17.L, anticorps Zcchc17
- Sujet
- ZCCHC17 contains 1 CCHC-type zinc finger and 1 S1 motif domain. The exact function of ZDHHC19 remains unknown.
- Poids moléculaire
- 27 kDa (MW of target protein)
-