ZCCHC17 anticorps (Middle Region)

N° du produit ABIN633208

Détail du produit anti-ZCCHC17 anticorps

Antigène: ZCCHC17 (Zinc Finger, CCHC Domain Containing 17 (ZCCHC17))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ZCCHC17 est non-conjugé

Application: Western Blotting (WB)

Specificité: ZCCHC17 antibody was raised against the middle region of ZCCHC17

Purification: Affinity purified

Immunogène: ZCCHC17 antibody was raised using the middle region of ZCCHC17 corresponding to a region with amino acids CFMQPGGTKYSLIPDEEEEKEEAKSAEFEKPDPTRNPSRKRKKEKKKKKH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ZCCHC17 Blocking Peptide, catalog no. 33R-1685, is also available for use as a blocking control in assays to test for specificity of this ZCCHC17 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZCCHC17 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ZCCHC17

Antigène: ZCCHC17 (Zinc Finger, CCHC Domain Containing 17 (ZCCHC17))

Autre désignation: ZCCHC17 (ZCCHC17 Produits)

Synonymes: anticorps HSPC251, anticorps PS1D, anticorps RP11-266K22.1, anticorps pNO40, anticorps ps1d, anticorps zgc:65790, anticorps zgc:85656, anticorps RGD1565267, anticorps pno40, anticorps hspc251, anticorps 2810055E05Rik, anticorps LDC4, anticorps pS1D, anticorps DKFZp459G2227, anticorps zinc finger CCHC-type containing 17, anticorps zinc finger, CCHC domain containing 17, anticorps zinc finger CCHC-type containing 17 L homeolog, anticorps ZCCHC17, anticorps zcchc17, anticorps zcchc17.L, anticorps Zcchc17

Sujet: ZCCHC17 contains 1 CCHC-type zinc finger and 1 S1 motif domain. The exact function of ZDHHC19 remains unknown.

Poids moléculaire: 27 kDa (MW of target protein)