SF3B3 anticorps (Middle Region)

N° du produit ABIN633217

Détail du produit anti-SF3B3 anticorps

Antigène: SF3B3 (Splicing Factor 3b, Subunit 3, 130kDa (SF3B3))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SF3B3 est non-conjugé

Application: Western Blotting (WB)

Specificité: SF3 B3 antibody was raised against the middle region of SF3 3

Purification: Affinity purified

Immunogène: SF3 B3 antibody was raised using the middle region of SF3 3 corresponding to a region with amino acids EHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQKNVSEELDRT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SF3B3 Blocking Peptide, catalog no. 33R-2457, is also available for use as a blocking control in assays to test for specificity of this SF3B3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SF0 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SF3B3

Antigène: SF3B3 (Splicing Factor 3b, Subunit 3, 130kDa (SF3B3))

Autre désignation: SF3B3 (SF3B3 Produits)

Synonymes: anticorps GB11574, anticorps rse1, anticorps sap130, anticorps sf3b130, anticorps staf130, anticorps sf3b3, anticorps 1810061H24Rik, anticorps 5730409A01Rik, anticorps AA409318, anticorps D8Ertd633e, anticorps RSE1, anticorps SAP130, anticorps mKIAA0017, anticorps ik:tdsubc_2b2, anticorps wu:fb81f05, anticorps xx:tdsubc_2b2, anticorps zgc:55440, anticorps SF3b130, anticorps STAF130, anticorps splicing factor 3b subunit 3, anticorps splicing factor 3B subunit 3, anticorps splicing factor 3b, subunit 3, 130kDa, anticorps splicing factor 3b subunit 3 L homeolog, anticorps splicing factor 3b, subunit 3, anticorps SF3B3, anticorps LOC550935, anticorps sf3b3, anticorps Sf3b3, anticorps LOC100178056, anticorps sf3b3.L

Sujet: SF3B3 is subunit 3 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence independent manner and may anchor the U2 snRNP to the pre-mRNA. Splicing factor 3b is also a component of the minor U12-type spliceosome. Subunit 3 has also been identified as a component of the STAGA (SPT3-TAF(II)31-GCN5L acetylase) transcription coactivator-HAT (histone acetyltransferase) complex, and the TFTC (TATA-binding-protein-free TAF(II)-containing complex). These complexes may function in chromatin modification, transcription, splicing, and DNA repair.

Poids moléculaire: 135 kDa (MW of target protein)