PRPF4 anticorps

N° du produit ABIN633223

Détail du produit anti-PRPF4 anticorps

Antigène: PRPF4 (PRP4 Pre-mRNA Processing Factor 4 Homolog (PRPF4))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PRPF4 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: PRPF4 antibody was raised using a synthetic peptide corresponding to a region with amino acids EVFEIEEHISERQAEVLAEFERRKRARQINVSTDDSEVKACLRALGEPIT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PRPF4 Blocking Peptide, catalog no. 33R-2784, is also available for use as a blocking control in assays to test for specificity of this PRPF4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRPF4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PRPF4

Antigène: PRPF4 (PRP4 Pre-mRNA Processing Factor 4 Homolog (PRPF4))

Autre désignation: PRPF4 (PRPF4 Produits)

Synonymes: anticorps zgc:65943, anticorps mg:ab03a02, anticorps GB19235, anticorps DDBDRAFT_0187564, anticorps DDBDRAFT_0233058, anticorps DDB_0187564, anticorps DDB_0233058, anticorps HPRP4, anticorps HPRP4P, anticorps PRP4, anticorps Prp4p, anticorps SNRNP60, anticorps 1600015H11Rik, anticorps AI874830, anticorps AW047464, anticorps bN189G18.1, anticorps pre-mRNA processing factor 4, anticorps PRP4 pre-mRNA processing factor 4 homolog (yeast), anticorps pre-mRNA processing factor 4 L homeolog, anticorps U4/U6 small nuclear ribonucleoprotein Prp4, anticorps U4/U6 small nuclear ribonucleoprotein, anticorps Prpf4, anticorps prpf4, anticorps prpf4.L, anticorps PRPF4, anticorps LOC409689

Sujet: The removal of introns from nuclear pre-mRNAs occurs on complexes called spliceosomes, which are made up of 4 small nuclear ribonucleoprotein (snRNP) particles and an undefined number of transiently associated splicing factors.

Poids moléculaire: 58 kDa (MW of target protein)