HNRNPH1 anticorps (Middle Region)

N° du produit ABIN633236

Détail du produit anti-HNRNPH1 anticorps

Antigène: HNRNPH1 (Heterogeneous Nuclear Ribonucleoprotein H1 (H) (HNRNPH1))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HNRNPH1 est non-conjugé

Application: Western Blotting (WB)

Specificité: HNRPH1 antibody was raised against the middle region of Hnrph1

Purification: Affinity purified

Immunogène: HNRPH1 antibody was raised using the middle region of Hnrph1 corresponding to a region with amino acids FLNSTAGASGGAYEHRYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HNRPH1 Blocking Peptide, catalog no. 33R-2975, is also available for use as a blocking control in assays to test for specificity of this HNRPH1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPH1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HNRNPH1

Antigène: HNRNPH1 (Heterogeneous Nuclear Ribonucleoprotein H1 (H) (HNRNPH1))

Autre désignation: HNRPH1 (HNRNPH1 Produits)

Synonymes: anticorps HNRPH, anticorps HNRPH1, anticorps hnRNPH, anticorps HNRNPH1, anticorps hnrph, anticorps hnrnph, anticorps hnrph1, anticorps hnrnph2, anticorps MGC78776, anticorps hnrph2, anticorps MGC80081, anticorps MGC130700, anticorps MGC69543, anticorps AI642080, anticorps E430005G16Rik, anticorps Hnrnph, anticorps Hnrph1, anticorps Hnrph, anticorps zgc:77712, anticorps heterogeneous nuclear ribonucleoprotein H1, anticorps heterogeneous nuclear ribonucleoprotein H2, anticorps heterogeneous nuclear ribonucleoprotein H1 S homeolog, anticorps heterogeneous nuclear ribonucleoprotein H1 L homeolog, anticorps HNRNPH1, anticorps HNRNPH2, anticorps hnrnph1.S, anticorps hnrnph1.L, anticorps hnrnph1, anticorps Hnrnph1

Sujet: HNRPH1 belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm.

Poids moléculaire: 49 kDa (MW of target protein)