HNRNPH1 anticorps (Middle Region)

N° du produit ABIN633236

L’anticorps anti-HNRNPH1 Polyclonal Lapin est utilisé pour la détection de HNRNPH1 dans des échantillons de Humain, Souris et Rat. Il a été validé pour WB.

Aperçu rapide pour HNRNPH1 anticorps (Middle Region) (ABIN633236)

Antigène: HNRNPH1 (Heterogeneous Nuclear Ribonucleoprotein H1 (H) (HNRNPH1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HNRNPH1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-HNRNPH1 anticorps

Épitope: Middle Region

Specificité: HNRPH1 antibody was raised against the middle region of Hnrph1

Purification: Affinity purified

Immunogène: HNRPH1 antibody was raised using the middle region of Hnrph1 corresponding to a region with amino acids FLNSTAGASGGAYEHRYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HNRPH1 Blocking Peptide, (ABIN938361), is also available for use as a blocking control in assays to test for specificity of this HNRPH1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPH1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HNRNPH1

Antigène: HNRNPH1 (Heterogeneous Nuclear Ribonucleoprotein H1 (H) (HNRNPH1))

Autre désignation: HNRPH1

Sujet: HNRPH1 belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm.

Poids moléculaire: 49 kDa (MW of target protein)