XPOT anticorps

N° du produit ABIN633241

Détail du produit anti-XPOT anticorps

Antigène: XPOT (Exportin, tRNA (Nuclear Export Receptor For TRNAs) (XPOT))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp XPOT est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: XPOT antibody was raised using a synthetic peptide corresponding to a region with amino acids TVLSDQQKANVEAIMLAVMKKLTYDEEYNFENEGEDEAMFVEYRKQLKLL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

XPOT Blocking Peptide, catalog no. 33R-9364, is also available for use as a blocking control in assays to test for specificity of this XPOT antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of XPOT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur XPOT

Antigène: XPOT (Exportin, tRNA (Nuclear Export Receptor For TRNAs) (XPOT))

Autre désignation: XPOT (XPOT Produits)

Synonymes: anticorps 110.t00019, anticorps XPO3, anticorps Exportin-T, anticorps si:ch211-286m4.4, anticorps exportin-T, anticorps 1110004L07Rik, anticorps 3110065H13Rik, anticorps AI452076, anticorps C79645, anticorps EXPORTIN-T, anticorps exportin T, anticorps exportin for tRNA, anticorps exportin, tRNA (nuclear export receptor for tRNAs), anticorps EHI_029040, anticorps XPOT, anticorps Xpot, anticorps xpot

Sujet: XPOT belonging to the RAN-GTPase exportin family that mediates export of tRNA from the nucleus to the cytoplasm. Translocation of tRNA to the cytoplasm occurs once exportin has bound both tRNA and GTP-bound RAN.

Poids moléculaire: 110 kDa (MW of target protein)