Pre-mRNA Branch Site Protein p14 (SF3B14) (Middle Region) anticorps
-
- Antigène Voir toutes Pre-mRNA Branch Site Protein p14 (SF3B14) Anticorps
- Pre-mRNA Branch Site Protein p14 (SF3B14)
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Inconjugué
-
Application
- Western Blotting (WB)
- Specificité
- SF3 B14 antibody was raised against the middle region of SF3 14
- Purification
- Affinity purified
- Immunogène
- SF3 B14 antibody was raised using the middle region of SF3 14 corresponding to a region with amino acids HLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK
- Top Product
- Discover our top product SF3B14 Anticorps primaire
-
-
- Indications d'application
-
WB: 2 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SF3B14 Blocking Peptide, catalog no. 33R-3788, is also available for use as a blocking control in assays to test for specificity of this SF3B14 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SF0 14 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Pre-mRNA Branch Site Protein p14 (SF3B14)
- Autre désignation
- SF3B14 (SF3B14 Produits)
- Synonymes
- anticorps 6030419K15Rik, anticorps AV001342, anticorps Sf3b14, anticorps zgc:86708, anticorps HSPC175, anticorps Ht006, anticorps P14, anticorps SAP14, anticorps SF3B14a, anticorps splicing factor 3B, subunit 6, anticorps splicing factor 3b, subunit 6, anticorps splicing factor 3b subunit 6 S homeolog, anticorps splicing factor 3b subunit 6, anticorps Sf3b6, anticorps sf3b6, anticorps sf3b6.S, anticorps SF3B6
- Sujet
- SF3B14 is a 14 kDa protein subunit of the splicing factor 3b complex. Splicing factor 3b associates with both the U2 and U11/U12 small nuclear ribonucleoprotein complexes (U2 snRNP) of spliceosomes. This 14 kDa protein interacts directly with subunit 1 of the splicing factor 3b complex. SF3B14 also interacts directly with the adenosine that carries out the first transesterification step of splicing at the pre-mRNA branch site.
- Poids moléculaire
- 14 kDa (MW of target protein)
-