Pre-mRNA Branch Site Protein p14 (SF3B14) (Middle Region) anticorps

N° du produit ABIN633280

Détail du produit

Antigène: Pre-mRNA Branch Site Protein p14 (SF3B14)

Épitope: Middle Region

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB)

Specificité: SF3 B14 antibody was raised against the middle region of SF3 14

Purification: Affinity purified

Immunogène: SF3 B14 antibody was raised using the middle region of SF3 14 corresponding to a region with amino acids HLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK

Information d'application

Indications d'application: WB: 2 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SF3B14 Blocking Peptide, catalog no. 33R-3788, is also available for use as a blocking control in assays to test for specificity of this SF3B14 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SF0 14 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: Pre-mRNA Branch Site Protein p14 (SF3B14)

Autre désignation: SF3B14 (SF3B14 Produits)

Synonymes: anticorps 6030419K15Rik, anticorps AV001342, anticorps Sf3b14, anticorps zgc:86708, anticorps HSPC175, anticorps Ht006, anticorps P14, anticorps SAP14, anticorps SF3B14a, anticorps splicing factor 3B, subunit 6, anticorps splicing factor 3b, subunit 6, anticorps splicing factor 3b subunit 6 S homeolog, anticorps splicing factor 3b subunit 6, anticorps Sf3b6, anticorps sf3b6, anticorps sf3b6.S, anticorps SF3B6

Sujet: SF3B14 is a 14 kDa protein subunit of the splicing factor 3b complex. Splicing factor 3b associates with both the U2 and U11/U12 small nuclear ribonucleoprotein complexes (U2 snRNP) of spliceosomes. This 14 kDa protein interacts directly with subunit 1 of the splicing factor 3b complex. SF3B14 also interacts directly with the adenosine that carries out the first transesterification step of splicing at the pre-mRNA branch site.

Poids moléculaire: 14 kDa (MW of target protein)