APOBEC1 anticorps (N-Term)

N° du produit ABIN633309

Détail du produit anti-APOBEC1 anticorps

Antigène: APOBEC1 (Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide 1 (APOBEC1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp APOBEC1 est non-conjugé

Application: Western Blotting (WB)

Specificité: ApoBEC1 antibody was raised against the N terminal of APOBEC1

Purification: Affinity purified

Immunogène: ApoBEC1 antibody was raised using the N terminal of APOBEC1 corresponding to a region with amino acids TSEKGPSTGDPTLRRRIEPWEFDVFYDPRELRKEACLLYEIKWGMSRKIW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ApoBEC1 Blocking Peptide, catalog no. 33R-9281, is also available for use as a blocking control in assays to test for specificity of this ApoBEC1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APOBEC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur APOBEC1

Antigène: APOBEC1 (Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide 1 (APOBEC1))

Autre désignation: ApoBEC1 (APOBEC1 Produits)

Synonymes: anticorps APOBEC-1, anticorps BEDP, anticorps CDAR1, anticorps HEPR, anticorps Cdar1, anticorps REPR, anticorps APOBEC1, anticorps apolipoprotein B mRNA editing enzyme catalytic subunit 1, anticorps apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1, anticorps APOBEC1, anticorps Apobec1

Sujet: APOBEC1 is a member of the cytidine deaminase enzyme family. The protein forms a multiple-protein editing holoenzyme with APOBEC1 complementation factor (ACF) and APOBEC1 stimulating protein (ASP). This holoenzyme is involved in the editing of C-to-U nucleotide bases in apolipoprotein B and neurofibromatosis-1 mRNAs.

Poids moléculaire: 28 kDa (MW of target protein)