BOLL anticorps

N° du produit ABIN633322

Détail du produit anti-BOLL anticorps

Antigène: BOLL (Bol, Boule-Like (BOLL))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp BOLL est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: BOLL antibody was raised using a synthetic peptide corresponding to a region with amino acids GGIDFKTNESDLRKFFSQYGSVKEVKIVNDRAGVSKGYGFVTFETQEDAQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

BOLL Blocking Peptide, catalog no. 33R-3288, is also available for use as a blocking control in assays to test for specificity of this BOLL antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BOLL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur BOLL

Antigène: BOLL (Bol, Boule-Like (BOLL))

Autre désignation: BOLL (BOLL Produits)

Synonymes: anticorps BOULE, anticorps 4930554P13Rik, anticorps 4930597B14Rik, anticorps RGD1559527, anticorps boule homolog, RNA binding protein, anticorps bol, boule-like (Drosophila), anticorps BOLL, anticorps Boll

Sujet: This gene belongs to the DAZ gene family required for germ cell development. BOLL is an RNA-binding protein which is more similar to Drosophila Boule than to human proteins encoded by genes DAZ (deleted in azoospermia) or DAZL (deleted in azoospermia-like). Loss of this gene function results in the absence of sperm in semen (azoospermia). Histological studies demonstrated that the primary defect is at the meiotic G2/M transition.

Poids moléculaire: 31 kDa (MW of target protein)