LSM6 anticorps

N° du produit ABIN633347

Détail du produit anti-LSM6 anticorps

Antigène: LSM6 (LSM6 Homolog, U6 Small Nuclear RNA Associated (LSM6))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LSM6 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: LSM6 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LSM6 Blocking Peptide, catalog no. 33R-6468, is also available for use as a blocking control in assays to test for specificity of this LSM6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LSM6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LSM6

Antigène: LSM6 (LSM6 Homolog, U6 Small Nuclear RNA Associated (LSM6))

Autre désignation: LSM6 (LSM6 Produits)

Synonymes: anticorps zgc:92379, anticorps YDR378C, anticorps 1500031N17Rik, anticorps 2410088K19Rik, anticorps AI747288, anticorps RGD1561937, anticorps LSM6 homolog, U6 small nuclear RNA and mRNA degradation associated S homeolog, anticorps LSM6 homolog, U6 small nuclear RNA and mRNA degradation associated, anticorps lsm6.S, anticorps lsm6, anticorps LSM6, anticorps Lsm6

Sujet: Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family. Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.

Poids moléculaire: 9 kDa (MW of target protein)