AUH anticorps (C-Term)

N° du produit ABIN633391

Détail du produit anti-AUH anticorps

Antigène: AUH (AU RNA Binding Protein/enoyl-CoA Hydratase (AUH))

Épitope: C-Term

Reactivité: Humain, Rat, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AUH est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: AUH antibody was raised against the C terminal of AUH

Purification: Affinity purified

Immunogène: AUH antibody was raised using the C terminal of AUH corresponding to a region with amino acids IGMSLAKELIFSARVLDGKEAKAVGLISHVLEQNQEGDAAYRKALDLARE

Information d'application

Indications d'application: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

AUH Blocking Peptide, catalog no. 33R-3974, is also available for use as a blocking control in assays to test for specificity of this AUH antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AUH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur AUH

Antigène: AUH (AU RNA Binding Protein/enoyl-CoA Hydratase (AUH))

Autre désignation: AUH (AUH Produits)

Synonymes: anticorps C77140, anticorps W91705, anticorps wu:fb81b10, anticorps zgc:101057, anticorps AU RNA binding methylglutaconyl-CoA hydratase, anticorps AU RNA binding protein/enoyl-coenzyme A hydratase, anticorps AU RNA binding protein/enoyl-CoA hydratase, anticorps AU RNA binding protein/enoyl-CoA hydratase S homeolog, anticorps AUH, anticorps Auh, anticorps auh, anticorps auh.S

Sujet: AU-specific RNA-binding enoyl-CoA hydratase (AUH) protein binds to the AU-rich element (ARE), a common element found in the 3' UTR of rapidly decaying mRNA such as c-fos, c-myc and granulocyte/ macrophage colony stimulating factor. ARE elements are involved in directing RNA to rapid degradation and deadenylation. AUH is also homologous to enol-CoA hydratase, an enzyme involved in fatty acid degradation, and has been shown to have intrinsic hydratase enzymatic activity. AUH is thus a bifunctional chimera between RNA binding and metabolic enzyme activity.

Poids moléculaire: 37 kDa (MW of target protein)