POLDIP3 anticorps

N° du produit ABIN633420

Détail du produit anti-POLDIP3 anticorps

Antigène: POLDIP3 (Polymerase (DNA-Directed), delta Interacting Protein 3 (POLDIP3))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp POLDIP3 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: POLDIP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids DAITAYKKYNNRCLDGQPMKCNLHMNGNVITSDQPILLRLSDSPSMKKES

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

POLDIP3 Blocking Peptide, catalog no. 33R-1855, is also available for use as a blocking control in assays to test for specificity of this POLDIP3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLDIP3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur POLDIP3

Antigène: POLDIP3 (Polymerase (DNA-Directed), delta Interacting Protein 3 (POLDIP3))

Autre désignation: POLDIP3 (POLDIP3 Produits)

Synonymes: anticorps PDIP46, anticorps SKAR, anticorps 1110008P04Rik, anticorps AA408269, anticorps AL022852, anticorps C77954, anticorps mKIAA1649, anticorps polymerase (DNA-directed), delta interacting protein 3 S homeolog, anticorps DNA polymerase delta interacting protein 3, anticorps polymerase (DNA-directed), delta interacting protein 3, anticorps poldip3.S, anticorps POLDIP3, anticorps Poldip3

Sujet: POLDIP3 is a protein that interacts with the DNA polymerase delta p50 subunit. This protein is a specific target of S6 kinase 1 and regulates cell growth. Two transcript variants that encode different protein isoforms have been identified.

Poids moléculaire: 46 kDa (MW of target protein)