CPNE1 anticorps (Middle Region)
-
- Antigène Voir toutes CPNE1 Anticorps
- CPNE1 (Copine I (CPNE1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CPNE1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Copine I antibody was raised against the middle region of CPNE1
- Purification
- Affinity purified
- Immunogène
- Copine I antibody was raised using the middle region of CPNE1 corresponding to a region with amino acids VQCSDYDSDGSHDLIGTFHTSLAQLQAVPAEFECIHPEKQQKKKSYKNSG
- Top Product
- Discover our top product CPNE1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Copine I Blocking Peptide, catalog no. 33R-9744, is also available for use as a blocking control in assays to test for specificity of this Copine I antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPNE1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CPNE1 (Copine I (CPNE1))
- Autre désignation
- Copine I (CPNE1 Produits)
- Synonymes
- anticorps CPNE1, anticorps MGC108079, anticorps COPN1, anticorps CPN1, anticorps 1810028N16Rik, anticorps mKIAA4108, anticorps cpne3, anticorps cpne3l, anticorps wu:fb69d07, anticorps wu:fc45a04, anticorps zgc:55873, anticorps copine I, anticorps copine 1, anticorps RNA-binding protein 12, anticorps copine-1, anticorps copine I L homeolog, anticorps CPNE1, anticorps cpne1, anticorps CPNE1b, anticorps LOC100032499, anticorps LOC100484845, anticorps EDI_033120, anticorps LOC100281056, anticorps cpne1.L, anticorps Cpne1
- Sujet
- Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. CPNE1 is a calcium-dependent protein that also contains two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus. However, the protein does not contain a predicted signal sequence or transmembrane domains. This protein has a broad tissue distribution and it may function in membrane trafficking. Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm.
- Poids moléculaire
- 59 kDa (MW of target protein)
-