TTC14 anticorps (N-Term)

N° du produit ABIN633440

Détail du produit anti-TTC14 anticorps

Antigène: TTC14 (Tetratricopeptide Repeat Domain 14 (TTC14))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TTC14 est non-conjugé

Application: Western Blotting (WB)

Specificité: TTC14 antibody was raised against the N terminal of TTC14

Purification: Affinity purified

Immunogène: TTC14 antibody was raised using the N terminal of TTC14 corresponding to a region with amino acids LLSLLRSEQQDNPHFRSLLGSAAEPARGPPPQHPLQGRKEKRVDNIEIQK

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TTC14 Blocking Peptide, catalog no. 33R-5194, is also available for use as a blocking control in assays to test for specificity of this TTC14 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TTC14 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TTC14

Antigène: TTC14 (Tetratricopeptide Repeat Domain 14 (TTC14))

Autre désignation: TTC14 (TTC14 Produits)

Synonymes: anticorps DRDL5813, anticorps PRO19630, anticorps 2700016E08Rik, anticorps 4930434D01Rik, anticorps 4931403I22Rik, anticorps 4933402I15Rik, anticorps AI662468, anticorps AU014779, anticorps AW561908, anticorps cI-44, anticorps mKIAA1980, anticorps zgc:113259, anticorps tetratricopeptide repeat domain 14, anticorps TTC14, anticorps Ttc14, anticorps ttc14

Sujet: TTC14 belongs to the TTC14 family and contains 1 S1 motif domain and 4 TPR repeats. The functions of TTC14 remain unknown.

Poids moléculaire: 88 kDa (MW of target protein)