TTC14 anticorps (N-Term)
-
- Antigène Voir toutes TTC14 Anticorps
- TTC14 (Tetratricopeptide Repeat Domain 14 (TTC14))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TTC14 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- TTC14 antibody was raised against the N terminal of TTC14
- Purification
- Affinity purified
- Immunogène
- TTC14 antibody was raised using the N terminal of TTC14 corresponding to a region with amino acids LLSLLRSEQQDNPHFRSLLGSAAEPARGPPPQHPLQGRKEKRVDNIEIQK
- Top Product
- Discover our top product TTC14 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TTC14 Blocking Peptide, catalog no. 33R-5194, is also available for use as a blocking control in assays to test for specificity of this TTC14 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TTC14 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TTC14 (Tetratricopeptide Repeat Domain 14 (TTC14))
- Autre désignation
- TTC14 (TTC14 Produits)
- Synonymes
- anticorps DRDL5813, anticorps PRO19630, anticorps 2700016E08Rik, anticorps 4930434D01Rik, anticorps 4931403I22Rik, anticorps 4933402I15Rik, anticorps AI662468, anticorps AU014779, anticorps AW561908, anticorps cI-44, anticorps mKIAA1980, anticorps zgc:113259, anticorps tetratricopeptide repeat domain 14, anticorps TTC14, anticorps Ttc14, anticorps ttc14
- Sujet
- TTC14 belongs to the TTC14 family and contains 1 S1 motif domain and 4 TPR repeats. The functions of TTC14 remain unknown.
- Poids moléculaire
- 88 kDa (MW of target protein)
-