EIF4G1 anticorps (Middle Region)

N° du produit ABIN633448

Détail du produit anti-EIF4G1 anticorps

Antigène: EIF4G1 (Eukaryotic Translation Initiation Factor 4 Gamma, 1 (EIF4G1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EIF4G1 est non-conjugé

Application: Western Blotting (WB)

Specificité: EIF4 G1 antibody was raised against the middle region of EIF4 1

Purification: Affinity purified

Immunogène: EIF4 G1 antibody was raised using the middle region of EIF4 1 corresponding to a region with amino acids PAVPEVENQPPAGSNPGPESEGSGVPPRPEEADETWDSKEDKIHNAENIQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EIF4G1 Blocking Peptide, catalog no. 33R-6989, is also available for use as a blocking control in assays to test for specificity of this EIF4G1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EIF4G1

Antigène: EIF4G1 (Eukaryotic Translation Initiation Factor 4 Gamma, 1 (EIF4G1))

Autre désignation: EIF4G1 (EIF4G1 Produits)

Synonymes: anticorps EIF4GI, anticorps CG10811, anticorps Dmel\\CG10811, anticorps EIF4G, anticorps Eif4G, anticorps deIF4G, anticorps eIF-4G, anticorps eIF4g, anticorps p200, anticorps EIF4G1, anticorps wu:fb50a05, anticorps wu:fc60b06, anticorps eif4g, anticorps CUCUMOVIRUS MULTIPLICATION 2, anticorps CUM2, anticorps EUKARYOTIC TRANSLATION INITIATION FACTOR 4G, anticorps eukaryotic translation initiation factor 4G, anticorps DDBDRAFT_0217646, anticorps DDBDRAFT_0217647, anticorps DDBDRAFT_0234257, anticorps DDB_0217646, anticorps DDB_0217647, anticorps DDB_0234257, anticorps NV18824, anticorps EIF-4G1, anticorps EIF4F, anticorps P220, anticorps PARK18, anticorps p220, anticorps E030015G23Rik, anticorps eIF4GI, anticorps eukaryotic translation initiation factor 4 gamma 1, anticorps eukaryotic translation initiation factor 4G, anticorps eukaryotic translation initiation factor 4 gamma, 1a, anticorps eukaryotic translation initiation factor 4 gamma, 1 S homeolog, anticorps eukaryotic initiation factor, anticorps eukaryotic translation initiation factor 4 gamma, anticorps eukaryotic translation initiation factor 4 gamma, 1, anticorps eukaryotic translation initiation factor 4, gamma 1, anticorps EIF4G1, anticorps eIF4G, anticorps eif4g1a, anticorps LOC704923, anticorps eif4g1.S, anticorps EIF4G, anticorps eIF4g, anticorps Eif4g, anticorps Eif4g1

Sujet: EIF4G1 is a component of the protein complex EIF4F, which is involved in the recognition of the mRNA cap, ATP-dependent unwinding of 5'-terminal secondary structure, and recruitment of mRNA to the ribosome.

Poids moléculaire: 175 kDa (MW of target protein)