CSTF3 anticorps (N-Term)

N° du produit ABIN633455

Détail du produit anti-CSTF3 anticorps

Antigène: CSTF3 (Cleavage Stimulation Factor, 3' Pre-RNA, Subunit 3, 77kDa (CSTF3))

Épitope: N-Term

Reactivité: Humain, Souris, Rat, Chien, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CSTF3 est non-conjugé

Application: Western Blotting (WB)

Specificité: CSTF3 antibody was raised against the N terminal of CSTF3

Purification: Affinity purified

Immunogène: CSTF3 antibody was raised using the N terminal of CSTF3 corresponding to a region with amino acids YIEAEIKAKNYDKVEKLFQRCLMKVLHIDLWKCYLSYVRETKGKLPSYKE

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CSTF3 Blocking Peptide, catalog no. 33R-10133, is also available for use as a blocking control in assays to test for specificity of this CSTF3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSTF3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CSTF3

Antigène: CSTF3 (Cleavage Stimulation Factor, 3' Pre-RNA, Subunit 3, 77kDa (CSTF3))

Autre désignation: CSTF3 (CSTF3 Produits)

Synonymes: anticorps cstf3, anticorps MGC76035, anticorps CSTF3, anticorps wu:fa99c02, anticorps wu:fb18b09, anticorps zgc:56028, anticorps 4732468G05Rik, anticorps C79532, anticorps CstF-77, anticorps cstf3a, anticorps CSTF-77, anticorps cleavage stimulation factor, 3' pre-RNA, subunit 3, anticorps cleavage stimulation factor subunit 3, anticorps cstf3, anticorps CSTF3, anticorps LOC100544392, anticorps LOC100641283, anticorps Cstf3, anticorps cstf3.S

Sujet: CSTF3 is one of three (including CSTF1 and CSTF2) cleavage stimulation factors that combine to form the cleavage stimulation factor complex (CSTF). This complex is involved in the polyadenylation and 3' end cleavage of pre-mRNAs. The protein functions as a homodimer and interacts directly with both CSTF1 and CSTF2 in the CSTF complex.

Poids moléculaire: 79 kDa (MW of target protein)