IGF2BP2 anticorps (Middle Region)
-
- Antigène Voir toutes IGF2BP2 Anticorps
- IGF2BP2 (Insulin-Like Growth Factor 2 mRNA Binding Protein 2 (IGF2BP2))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp IGF2BP2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- IGF2 BP2 antibody was raised against the middle region of IGF2 P2
- Purification
- Affinity purified
- Immunogène
- IGF2 BP2 antibody was raised using the middle region of IGF2 P2 corresponding to a region with amino acids QANLIPGLNLSALGIFSTGLSVLSPPAGPRGAPPAAPYHPFTTHSGYFSS
- Top Product
- Discover our top product IGF2BP2 Anticorps primaire
-
anti-Insulin-Like Growth Factor 2 mRNA Binding Protein 2 (IGF2BP2) antibody
IGF2BP2 Reactivité: Humain, Singe WB, IHC, IF, FACS, IHC (p) Hôte: Souris Monoclonal 5G3 unconjugated
anti-Insulin-Like Growth Factor 2 mRNA Binding Protein 2 (IGF2BP2) antibodyIGF2BP2 Reactivité: Humain, Singe, Chien WB, IHC, IF, FACS, IHC (p) Hôte: Souris Monoclonal 4C4 unconjugated
anti-Insulin-Like Growth Factor 2 mRNA Binding Protein 2 (IGF2BP2) (AA 1-598) antibodyIGF2BP2 Reactivité: Humain WB, ELISA, IP Hôte: Souris Monoclonal 4C6 unconjugated
anti-Insulin-Like Growth Factor 2 mRNA Binding Protein 2 (IGF2BP2) antibodyIGF2BP2 Reactivité: Humain, Singe WB, IF, FACS Hôte: Souris Monoclonal 2H7 unconjugated
anti-Insulin-Like Growth Factor 2 mRNA Binding Protein 2 (IGF2BP2) (Middle Region) antibodyIGF2BP2 Reactivité: Humain, Souris, Rat, Chien, Cheval, Boeuf (Vache), Lapin, Cobaye, Saccharomyces cerevisiae WB Hôte: Lapin Polyclonal unconjugated
anti-Insulin-Like Growth Factor 2 mRNA Binding Protein 2 (IGF2BP2) (C-Term) antibodyIGF2BP2 Reactivité: Humain WB, IHC, IF Hôte: Lapin Polyclonal unconjugated
anti-Insulin-Like Growth Factor 2 mRNA Binding Protein 2 (IGF2BP2) (AA 530-556), (C-Term) antibodyIGF2BP2 Reactivité: Humain WB, FACS, IHC (p) Hôte: Lapin Polyclonal RB21527 unconjugated
anti-Insulin-Like Growth Factor 2 mRNA Binding Protein 2 (IGF2BP2) antibodyIGF2BP2 Reactivité: Humain, Souris WB, IHC, IF Hôte: Lapin Polyclonal unconjugated
anti-Insulin-Like Growth Factor 2 mRNA Binding Protein 2 (IGF2BP2) (AA 1-598) antibodyIGF2BP2 Reactivité: Humain WB, IF Hôte: Souris Polyclonal unconjugated
anti-Insulin-Like Growth Factor 2 mRNA Binding Protein 2 (IGF2BP2) (AA 330-599) antibodyIGF2BP2 Reactivité: Humain WB, IHC, IF Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
IGF2BP2 Blocking Peptide, catalog no. 33R-7470, is also available for use as a blocking control in assays to test for specificity of this IGF2BP2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IGF0 P2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- IGF2BP2 (Insulin-Like Growth Factor 2 mRNA Binding Protein 2 (IGF2BP2))
- Autre désignation
- IGF2BP2 (IGF2BP2 Produits)
- Synonymes
- anticorps IMP-2, anticorps IMP2, anticorps VICKZ2, anticorps p62, anticorps C330012H03Rik, anticorps Imp2, anticorps Neilsen, anticorps RGD1305614, anticorps insulin like growth factor 2 mRNA binding protein 2, anticorps insulin-like growth factor 2 mRNA binding protein 2, anticorps IGF2BP2, anticorps Igf2bp2
- Sujet
- IGF2BP2 binds to the 5'-UTR of the insulin-like growth factor 2 (IGF2) mRNAs. Binding is isoform-specific. IGF2BP2 may regulate translation of target mRNAs.
- Poids moléculaire
- 66 kDa (MW of target protein)
-
