Synaptojanin 2 anticorps (N-Term)

N° du produit ABIN633514

Détail du produit anti-Synaptojanin 2 anticorps

Antigène: Synaptojanin 2 (SYNJ2)

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Synaptojanin 2 est non-conjugé

Application: Western Blotting (WB)

Specificité: Synaptojanin 2 antibody was raised against the N terminal of SYNJ2

Purification: Affinity purified

Immunogène: Synaptojanin 2 antibody was raised using the N terminal of SYNJ2 corresponding to a region with amino acids SGGTSLSFLVLVTGCTSVGRIPDAEIYKITATDFYPLQEEAKEEERLIAL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Synaptojanin 2 Blocking Peptide, catalog no. 33R-8466, is also available for use as a blocking control in assays to test for specificity of this Synaptojanin 2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SYNJ2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Synaptojanin 2

Antigène: Synaptojanin 2 (SYNJ2)

Autre désignation: Synaptojanin 2 (SYNJ2 Produits)

Synonymes: anticorps SYNJ2, anticorps INPP5H, anticorps AI481647, anticorps SJ2, anticorps mKIAA0348, anticorps synaptojanin 2, anticorps synaptojanin-2, anticorps SYNJ2, anticorps LOC100074269, anticorps synj2, anticorps Synj2

Sujet: SYNJ2 may play a role in allowing polymerase epsilon to carry out its replication and/or repair function.

Poids moléculaire: 165 kDa (MW of target protein)

Pathways: Inositol Metabolic Process