Splicing Factor 4 anticorps (Middle Region)

N° du produit ABIN633552

Détail du produit anti-Splicing Factor 4 anticorps

Antigène: Splicing Factor 4 (SF4)

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Splicing Factor 4 est non-conjugé

Application: Western Blotting (WB)

Specificité: SF4 antibody was raised against the middle region of SF4

Purification: Affinity purified

Immunogène: SF4 antibody was raised using the middle region of SF4 corresponding to a region with amino acids TFKALKEGREPDYSEYKEFKLTVENIGYQMLMKMGWKEGEGLGSEGQGIK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SF4 Blocking Peptide, catalog no. 33R-9065, is also available for use as a blocking control in assays to test for specificity of this SF4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SF4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Splicing Factor 4

Antigène: Splicing Factor 4 (SF4)

Autre désignation: SF4 (SF4 Produits)

Synonymes: anticorps SF4, anticorps rbp, anticorps f23858, anticorps F23858, anticorps RBP, anticorps 5730496N02Rik, anticorps Sf4, anticorps sf4, anticorps SURP and G-patch domain containing 1, anticorps SURP and G patch domain containing 1, anticorps SURP and G-patch domain containing 1 S homeolog, anticorps SUGP1, anticorps sugp1, anticorps Sugp1, anticorps sugp1.S

Sujet: SF4 is a member of the SURP family of splicing factors. SF4 is a member of the SURP family of splicing factors.

Poids moléculaire: 72 kDa (MW of target protein)