NOP56 anticorps
-
- Antigène Voir toutes NOP56 Anticorps
- NOP56 (NOP56 Ribonucleoprotein Homolog (NOP56))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NOP56 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- NOL5 A antibody was raised using a synthetic peptide corresponding to a region with amino acids EERLSFYETGEIPRKNLDVMKEAMVQAEEAAAEITRKLEKQEKKRLKKKK
- Top Product
- Discover our top product NOP56 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NOL5A Blocking Peptide, catalog no. 33R-2386, is also available for use as a blocking control in assays to test for specificity of this NOL5A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOL0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NOP56 (NOP56 Ribonucleoprotein Homolog (NOP56))
- Autre désignation
- NOL5A (NOP56 Produits)
- Synonymes
- anticorps An16g03090, anticorps AO090005001291, anticorps NOL5A, anticorps SCA36, anticorps 2310044F10Rik, anticorps Nol5a, anticorps nol5a, anticorps nucleolar protein 56, anticorps NOP56 ribonucleoprotein, anticorps NOP56 ribonucleoprotein homolog, anticorps ANI_1_440144, anticorps AOR_1_2236174, anticorps NOP56, anticorps Nop56, anticorps nop56
- Sujet
- Nop56p is a yeast nucleolar protein that is part of a complex with the nucleolar proteins Nop58p and fibrillarin. Nop56p is required for assembly of the 60S ribosomal subunit and is involved in pre-rRNA processing. NOL5A is similar in sequence to Nop56p and is also found in the nucleolus. Multiple transcript variants encoding several different isoforms have been found for this gene, but the full-length nature of most of them have not been determined.
- Poids moléculaire
- 48 kDa (MW of target protein)
-