EIF1AX anticorps (Middle Region)

N° du produit ABIN633587

Détail du produit anti-EIF1AX anticorps

Antigène: EIF1AX (Eukaryotic Translation Initiation Factor 1A, X-Linked (EIF1AX))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EIF1AX est non-conjugé

Application: Western Blotting (WB)

Specificité: EIF1 AX antibody was raised against the middle region of EIF1 X

Purification: Affinity purified

Immunogène: EIF1 AX antibody was raised using the middle region of EIF1 X corresponding to a region with amino acids KYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EIF1AX Blocking Peptide, catalog no. 33R-4747, is also available for use as a blocking control in assays to test for specificity of this EIF1AX antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 X antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EIF1AX

Antigène: EIF1AX (Eukaryotic Translation Initiation Factor 1A, X-Linked (EIF1AX))

Autre désignation: EIF1AX (EIF1AX Produits)

Synonymes: anticorps Eif1ay, anticorps RGD1560198, anticorps 1500010B24Rik, anticorps AI426898, anticorps EIF1A, anticorps EIF1AP1, anticorps EIF4C, anticorps eIF-1A, anticorps eIF-4C, anticorps eif-1a, anticorps eif-4c, anticorps eif1a, anticorps eif1ap1, anticorps eif1ax, anticorps eif4c, anticorps zgc:101670, anticorps EIF1AY, anticorps eukaryotic translation initiation factor 1A, X-linked, anticorps eukaryotic translation initiation factor 1A, X-linked S homeolog, anticorps eukaryotic translation initiation factor 1A, X-linked, a, anticorps Eif1ax, anticorps EIF1AX, anticorps eif1ax.S, anticorps eif1axa

Sujet: This gene encodes an essential eukaryotic translation initiation factor. The protein is required for the binding of the 43S complex (a 40S subunit, eIF2/GTP/Met-tRNAi and eIF3) to the 5' end of capped RNA.

Poids moléculaire: 16 kDa (MW of target protein)