DDX28 anticorps

N° du produit ABIN633598

Détail du produit anti-DDX28 anticorps

Antigène: DDX28 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 28 (DDX28))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DDX28 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: DDX28 antibody was raised using a synthetic peptide corresponding to a region with amino acids FSIERAQQEAPAVRKLSSKGSFADLGLEPRVLHALQEAAPEVVQPTTVQS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DDX28 Blocking Peptide, catalog no. 33R-3063, is also available for use as a blocking control in assays to test for specificity of this DDX28 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX28 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DDX28

Antigène: DDX28 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 28 (DDX28))

Autre désignation: DDX28 (DDX28 Produits)

Synonymes: anticorps MDDX28, anticorps 2410004K13Rik, anticorps AI449652, anticorps Mddx28, anticorps DEAD-box helicase 28, anticorps DEAD (Asp-Glu-Ala-Asp) box polypeptide 28, anticorps DDX28, anticorps Ddx28

Sujet: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX28 is an RNA-dependent ATPase. DDX28 is localized in the mitochondria and the nucleus, and can be transported between the mitochondria and the nucleus.

Poids moléculaire: 59 kDa (MW of target protein)