TIA1 anticorps (C-Term)
-
- Antigène Voir toutes TIA1 Anticorps
- TIA1 (TIA1 Cytotoxic Granule-Associated RNA Binding Protein (TIA1))
-
Épitope
- C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TIA1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- TIA1 antibody was raised against the C terminal of TIA1
- Purification
- Affinity purified
- Immunogène
- TIA1 antibody was raised using the C terminal of TIA1 corresponding to a region with amino acids QAWNQQGFNQTQSSAPWMGPNYGVQPPQGQNGSMLPNQPSGYRVAGYETQ
- Top Product
- Discover our top product TIA1 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TIA1 Blocking Peptide, catalog no. 33R-7484, is also available for use as a blocking control in assays to test for specificity of this TIA1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TIA1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TIA1 (TIA1 Cytotoxic Granule-Associated RNA Binding Protein (TIA1))
- Autre désignation
- TIA1 (TIA1 Produits)
- Synonymes
- anticorps tia1, anticorps 2310050N03Rik, anticorps AI256674, anticorps TIA-1, anticorps mTIA-1, anticorps WDM, anticorps TIAL1, anticorps TIAR, anticorps tia-1, anticorps nucleolysin TIA-1 isoform p40, anticorps hypothetical protein, anticorps nucleolysin TIAR, anticorps nucleolysin tia-1, anticorps nucleolysin TIA-1, anticorps cytotoxic granule-associated RNA binding protein 1, anticorps TIA1 cytotoxic granule associated RNA binding protein, anticorps TIA1 cytotoxic granule-associated RNA binding protein, anticorps TIA1 cytotoxic granule-associated RNA binding protein L homeolog, anticorps PTRG_10065, anticorps PGTG_08590, anticorps LOC5568274, anticorps CpipJ_CPIJ013665, anticorps VDBG_07004, anticorps MGYG_03339, anticorps Tsp_15456, anticorps tia1, anticorps Tia1, anticorps TIA1, anticorps tia1.L
- Sujet
- TIA1 is a member of a RNA-binding protein family and possesses nucleolytic activity against cytotoxic lymphocyte (CTL) target cells. It has been suggested that this protein may be involved in the induction of apoptosis as it preferentially recognises poly(A) homopolymers and induces DNA fragmentation in CTL targets. The major granule-associated species is a 15 kDa protein that is thought to be derived from the carboxyl terminus of the 40 kDa product by proteolytic processing.
- Poids moléculaire
- 42 kDa (MW of target protein)
-