CLIC6 anticorps (Middle Region)

N° du produit ABIN633620

Détail du produit anti-CLIC6 anticorps

Antigène: CLIC6 (Chloride Intracellular Channel 6 (CLIC6))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CLIC6 est non-conjugé

Application: Western Blotting (WB)

Specificité: CLIC6 antibody was raised against the middle region of CLIC6

Purification: Affinity purified

Immunogène: CLIC6 antibody was raised using the middle region of CLIC6 corresponding to a region with amino acids RREDGEASEPRALGQEHDITLFVKAGYDGESIGNCPFSQRLFMILWLKGV

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CLIC6 Blocking Peptide, catalog no. 33R-8134, is also available for use as a blocking control in assays to test for specificity of this CLIC6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLIC6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CLIC6

Antigène: CLIC6 (Chloride Intracellular Channel 6 (CLIC6))

Autre désignation: CLIC6 (CLIC6 Produits)

Synonymes: anticorps CLIC6, anticorps CLIC1L, anticorps 5730466J16Rik, anticorps AL022908, anticorps AW045520, anticorps Clic6b, anticorps chloride intracellular channel 6, anticorps CLIC6, anticorps Clic6

Sujet: CLIon Channel6 encodes a member of the chloride intracellular channel family of proteins. The gene is part of a large triplicated region found on chromosomes 1, 6, and 21.

Poids moléculaire: 75 kDa (MW of target protein)