TOMM40L anticorps
-
- Antigène Voir toutes TOMM40L Anticorps
- TOMM40L (Translocase of Outer Mitochondrial Membrane 40 Like (TOMM40L))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TOMM40L est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- TOMM40 L antibody was raised using a synthetic peptide corresponding to a region with amino acids GGAHASYYHRANEQVQVGVEFEANTRLQDTTFSFGYHLTLPQANMVFRGL
- Top Product
- Discover our top product TOMM40L Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TOMM40L Blocking Peptide, catalog no. 33R-3272, is also available for use as a blocking control in assays to test for specificity of this TOMM40L antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TOMM40 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TOMM40L (Translocase of Outer Mitochondrial Membrane 40 Like (TOMM40L))
- Autre désignation
- TOMM40L (TOMM40L Produits)
- Synonymes
- anticorps RP11-297K8.10, anticorps TOMM40B, anticorps Tom40B, anticorps RGD1562006, anticorps Tomm40b, anticorps zgc:85715, anticorps translocase of outer mitochondrial membrane 40 like, anticorps translocase of outer mitochondrial membrane 40 homolog-like (yeast), anticorps translocase of outer mitochondrial membrane 40 homolog, like, anticorps TOMM40L, anticorps Tomm40l, anticorps tomm40l
- Sujet
- TOMM40L is a potential channel-forming protein implicated in import of protein precursors into mitochondria.
- Poids moléculaire
- 34 kDa (MW of target protein)
-