KCNMB4 anticorps (Middle Region)
-
- Antigène Voir toutes KCNMB4 Anticorps
- KCNMB4 (Potassium Large Conductance Calcium-Activated Channel, Subfamily M, beta Member 4 (KCNMB4))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp KCNMB4 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- KCNMB4 antibody was raised against the middle region of KCNMB4
- Purification
- Affinity purified
- Immunogène
- KCNMB4 antibody was raised using the middle region of KCNMB4 corresponding to a region with amino acids TCGADCRGTSQYPCVQVYVNNSESNSRALLHSDEHQLLTNPKCSYIPPCK
- Top Product
- Discover our top product KCNMB4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
KCNMB4 Blocking Peptide, catalog no. 33R-8994, is also available for use as a blocking control in assays to test for specificity of this KCNMB4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNMB4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- KCNMB4 (Potassium Large Conductance Calcium-Activated Channel, Subfamily M, beta Member 4 (KCNMB4))
- Autre désignation
- KCNMB4 (KCNMB4 Produits)
- Synonymes
- anticorps 1700058G18Rik, anticorps 2900045G12Rik, anticorps kcnmb4, anticorps potassium calcium-activated channel subfamily M regulatory beta subunit 4, anticorps potassium large conductance calcium-activated channel, subfamily M, beta member 4, anticorps potassium channel subfamily M regulatory beta subunit 4, anticorps Kcnmb4, anticorps KCNMB4, anticorps kcnmb4
- Sujet
- KCNMB4 is the regulatory subunit of the calcium activated potassium KCNMA1 (maxiK) channel. KCNMB4 modulates the calcium sensitivity and gating kinetics of KCNMA1, thereby contributing to KCNMA1 channel diversity. KCNMB4 decreases the gating kinetics and calcium sensitivity of the KCNMA1 channel, but with fast deactivation kinetics. KCNMB4 may decrease KCNMA1 channel openings at low calcium concentrations but increases channel openings at high calcium concentrations. KCNMB4 makes KCNMA1 channel resistant to 100 nM charybdotoxin (CTX) toxin concentrations.
- Poids moléculaire
- 24 kDa (MW of target protein)
-