KCND2 anticorps (Middle Region)

N° du produit ABIN633682

Détail du produit anti-KCND2 anticorps

Antigène: KCND2 (Potassium Voltage-Gated Channel, Shal-Related Subfamily, Member 2 (KCND2))

Épitope: Middle Region

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KCND2 est non-conjugé

Application: Western Blotting (WB)

Specificité: KCND2 antibody was raised against the middle region of KCND2

Purification: Affinity purified

Immunogène: KCND2 antibody was raised using the middle region of KCND2 corresponding to a region with amino acids RIRAAKSGSANAYMQSKRNGLLSNQLQSSEDEQAFVSKSGSSFETQHHHL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KCND2 Blocking Peptide, catalog no. 33R-7976, is also available for use as a blocking control in assays to test for specificity of this KCND2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCND2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KCND2

Antigène: KCND2 (Potassium Voltage-Gated Channel, Shal-Related Subfamily, Member 2 (KCND2))

Autre désignation: KCND2 (KCND2 Produits)

Synonymes: anticorps KCND2, anticorps si:dkey-24j9.3, anticorps si:dkeyp-97c5.3, anticorps DKFZp459P1550, anticorps AI839615, anticorps AW555701, anticorps Kv4.2, anticorps R75121, anticorps mKIAA1044, anticorps KV4.2, anticorps RK5, anticorps Shal1, anticorps potassium voltage-gated channel subfamily D member 2, anticorps potassium voltage-gated channel, Shal-related subfamily, member 2, anticorps potassium voltage-gated channel, Shal-related family, member 2, anticorps KCND2, anticorps kcnd2, anticorps Kcnd2, anticorps LOC101669961

Sujet: Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). KCND2 is a member of the potassium channel, voltage-gated, shal-related subfamily, members of which form voltage-activated A-type potassium ion channels and are prominent in the repolarization phase of the action potential.

Poids moléculaire: 70 kDa (MW of target protein)