KCNA10 anticorps (N-Term)
-
- Antigène Voir toutes KCNA10 Anticorps
- KCNA10 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 10 (KCNA10))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp KCNA10 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- KCNA10 antibody was raised against the N terminal of KCNA10
- Purification
- Affinity purified
- Immunogène
- KCNA10 antibody was raised using the N terminal of KCNA10 corresponding to a region with amino acids DVCGWKEMEVALVNFDNSDEIQEEPGYATDFDSTSPKGRPGGSSFSNGKI
- Top Product
- Discover our top product KCNA10 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
KCNA10 Blocking Peptide, catalog no. 33R-2212, is also available for use as a blocking control in assays to test for specificity of this KCNA10 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNA10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- KCNA10 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 10 (KCNA10))
- Autre désignation
- KCNA10 (KCNA10 Produits)
- Synonymes
- anticorps cKv1.2, anticorps Kcn1, anticorps Kv1.8, anticorps Gm1962, anticorps Kcna8, anticorps potassium voltage-gated channel subfamily A member 10, anticorps potassium voltage-gated channel, shaker-related subfamily, member 10, anticorps KCNA10, anticorps Kcna10
- Sujet
- KCNA10 is a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It is specifically regulated by cGMP and postulated to mediate the effects of substances that increase intracellular cGMP. This gene is intronless, and the gene is clustered with genes KCNA2 and KCNA3 on chromosome 1.
- Poids moléculaire
- 58 kDa (MW of target protein)
-