KCNK12 anticorps (Middle Region)

N° du produit ABIN633703

Détail du produit anti-KCNK12 anticorps

Antigène: KCNK12 (Potassium Channel, Subfamily K, Member 12 (KCNK12))

Épitope: Middle Region

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KCNK12 est non-conjugé

Application: Western Blotting (WB)

Specificité: KCNK12 antibody was raised against the middle region of KCNK12

Purification: Affinity purified

Immunogène: KCNK12 antibody was raised using the middle region of KCNK12 corresponding to a region with amino acids EGRRLSGELISMRDLTASNKVSLALLQKQLSETANGYPRSVCVNTRQNGF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KCNK12 Blocking Peptide, catalog no. 33R-2445, is also available for use as a blocking control in assays to test for specificity of this KCNK12 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNK12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KCNK12

Antigène: KCNK12 (Potassium Channel, Subfamily K, Member 12 (KCNK12))

Autre désignation: KCNK12 (KCNK12 Produits)

Synonymes: anticorps KCNK12, anticorps K2p12.1, anticorps THIK-2, anticorps THIK2, anticorps mntk1, anticorps potassium two pore domain channel subfamily K member 12, anticorps potassium channel, subfamily K, member 12, anticorps KCNK12, anticorps Kcnk12

Sujet: KCNK12 is a member of the superfamily of potassium channel proteins containing two pore-forming P domains. KCNK12 has not been shown to be a functional channel, however, it may require other non-pore-forming proteins for activity.

Poids moléculaire: 47 kDa (MW of target protein)