KCNJ4 anticorps (Middle Region)
-
- Antigène Voir toutes KCNJ4 Anticorps
- KCNJ4 (Potassium Inwardly-Rectifying Channel, Subfamily J, Member 4 (KCNJ4))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp KCNJ4 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- KCNJ4 antibody was raised against the middle region of KCNJ4
- Purification
- Affinity purified
- Immunogène
- KCNJ4 antibody was raised using the middle region of KCNJ4 corresponding to a region with amino acids AVAAGLGLEAGSKEEAGIIRMLEFGSHLDLERMQASLPLDNISYRRESAI
- Top Product
- Discover our top product KCNJ4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
KCNJ4 Blocking Peptide, catalog no. 33R-1580, is also available for use as a blocking control in assays to test for specificity of this KCNJ4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNJ4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- KCNJ4 (Potassium Inwardly-Rectifying Channel, Subfamily J, Member 4 (KCNJ4))
- Autre désignation
- KCNJ4 (KCNJ4 Produits)
- Synonymes
- anticorps KCNJ4, anticorps CKIR2.3, anticorps HIR, anticorps HIRK2, anticorps HRK1, anticorps IRK-3, anticorps IRK3, anticorps Kir2.3, anticorps Kcnf2, anticorps MB-IRK3, anticorps Hirk2, anticorps potassium voltage-gated channel subfamily J member 4, anticorps potassium inwardly-rectifying channel, subfamily J, member 4, anticorps KCNJ4, anticorps Kcnj4
- Sujet
- KCNJ4 is an integral membrane protein and member of the inward rectifier potassium channel family. The encoded protein has a small unitary conductance compared to other members of this protein family.
- Poids moléculaire
- 49 kDa (MW of target protein)
-