KCNJ4 anticorps (Middle Region)

N° du produit ABIN633711

Détail du produit anti-KCNJ4 anticorps

Antigène: KCNJ4 (Potassium Inwardly-Rectifying Channel, Subfamily J, Member 4 (KCNJ4))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KCNJ4 est non-conjugé

Application: Western Blotting (WB)

Specificité: KCNJ4 antibody was raised against the middle region of KCNJ4

Purification: Affinity purified

Immunogène: KCNJ4 antibody was raised using the middle region of KCNJ4 corresponding to a region with amino acids AVAAGLGLEAGSKEEAGIIRMLEFGSHLDLERMQASLPLDNISYRRESAI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KCNJ4 Blocking Peptide, catalog no. 33R-1580, is also available for use as a blocking control in assays to test for specificity of this KCNJ4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNJ4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KCNJ4

Antigène: KCNJ4 (Potassium Inwardly-Rectifying Channel, Subfamily J, Member 4 (KCNJ4))

Autre désignation: KCNJ4 (KCNJ4 Produits)

Synonymes: anticorps KCNJ4, anticorps CKIR2.3, anticorps HIR, anticorps HIRK2, anticorps HRK1, anticorps IRK-3, anticorps IRK3, anticorps Kir2.3, anticorps Kcnf2, anticorps MB-IRK3, anticorps Hirk2, anticorps potassium voltage-gated channel subfamily J member 4, anticorps potassium inwardly-rectifying channel, subfamily J, member 4, anticorps KCNJ4, anticorps Kcnj4

Sujet: KCNJ4 is an integral membrane protein and member of the inward rectifier potassium channel family. The encoded protein has a small unitary conductance compared to other members of this protein family.

Poids moléculaire: 49 kDa (MW of target protein)