PKDREJ anticorps (Middle Region)

N° du produit ABIN633777

Détail du produit anti-PKDREJ anticorps

Antigène: PKDREJ (Polycystic Kidney Disease and Receptor for Egg Jelly-Related Protein (PKDREJ))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PKDREJ est non-conjugé

Application: Western Blotting (WB)

Specificité: PKDREJ antibody was raised against the middle region of PKDREJ

Purification: Affinity purified

Immunogène: PKDREJ antibody was raised using the middle region of PKDREJ corresponding to a region with amino acids GVADNGSVLEITPDVAEVYLVRKNLTFAAFNLTVGPNSEVDGSLKKTTGG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PKDREJ Blocking Peptide, catalog no. 33R-3627, is also available for use as a blocking control in assays to test for specificity of this PKDREJ antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PKDREJ antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PKDREJ

Antigène: PKDREJ (Polycystic Kidney Disease and Receptor for Egg Jelly-Related Protein (PKDREJ))

Autre désignation: PKDREJ (PKDREJ Produits)

Synonymes: anticorps polycystin family receptor for egg jelly, anticorps polycystic kidney disease (polycystin) and REJ homolog (sperm receptor for egg jelly homolog, sea urchin), anticorps polycystin (PKD) family receptor for egg jelly, anticorps Pkdrej, anticorps PKDREJ

Sujet: PkDaREJ is a member of the polycystin protein family. The encoded protein contains 11 transmembrane domains, a receptor for egg jelly (REJ) domain, a G-protein-coupled receptor proteolytic site (GPS) domain, and a polycystin-1, lipoxygenase, alpha-toxin (PLAT) domain. This protein may play a role in human reproduction.

Poids moléculaire: 254 kDa (MW of target protein)