ST8SIA4 anticorps (Middle Region)

N° du produit ABIN633811

Détail du produit anti-ST8SIA4 anticorps

Antigène: ST8SIA4 (ST8 alpha-N-Acetyl-Neuraminide alpha-2,8-Sialyltransferase 4 (ST8SIA4))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ST8SIA4 est non-conjugé

Application: Western Blotting (WB)

Specificité: ST8 SIA4 antibody was raised against the middle region of ST8 IA4

Purification: Affinity purified

Immunogène: ST8 SIA4 antibody was raised using the middle region of ST8 IA4 corresponding to a region with amino acids DVGTKSDFITMNPSVVQRAFGGFRNESDREKFVHRLSMLNDSVLWIPAFM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ST8SIA4 Blocking Peptide, catalog no. 33R-2214, is also available for use as a blocking control in assays to test for specificity of this ST8SIA4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST0 IA4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ST8SIA4

Antigène: ST8SIA4 (ST8 alpha-N-Acetyl-Neuraminide alpha-2,8-Sialyltransferase 4 (ST8SIA4))

Autre désignation: ST8SIA4 (ST8SIA4 Produits)

Synonymes: anticorps PST, anticorps PST-1, anticorps SIAT8-D, anticorps ST8SiaIV, anticorps Siat8d, anticorps PST1, anticorps SIAT8D, anticorps ST8SIA-IV, anticorps ST8Sia-IV, anticorps pst, anticorps siat 8D, anticorps ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 4, anticorps St8sia4, anticorps ST8SIA4, anticorps st8sia4

Sujet: ST8SIA4 catalyzes the polycondensation of alpha-2,8-linked sialic acid required for the synthesis of polysialic acid, a modulator of the adhesive properties of neural cell adhesion molecule (NCAM1). ST8SIA4, a member of glycosyltransferase family 29, is a type II membrane protein that may be present in the Golgi apparatus.

Poids moléculaire: 41 kDa (MW of target protein)