HEY1 anticorps (Middle Region)

N° du produit ABIN633814

Détail du produit anti-HEY1 anticorps

Antigène: HEY1 (Ha-Ry/enhancer-of-Split Related with YRPW Motif 1 (HEY1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HEY1 est non-conjugé

Application: Western Blotting (WB)

Specificité: HEY1 antibody was raised against the middle region of HEY1

Purification: Affinity purified

Immunogène: HEY1 antibody was raised using the middle region of HEY1 corresponding to a region with amino acids HQGRLGSAHPEAPALRAPPSGSLGPVLPVVTSASKLSPPLLSSVASLSAF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HEY1 Blocking Peptide, catalog no. 33R-3822, is also available for use as a blocking control in assays to test for specificity of this HEY1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HEY1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HEY1

Antigène: HEY1 (Ha-Ry/enhancer-of-Split Related with YRPW Motif 1 (HEY1))

Autre désignation: HEY1 (HEY1 Produits)

Synonymes: anticorps BHLHb31, anticorps CHF2, anticorps HERP2, anticorps HESR1, anticorps HRT-1, anticorps OAF1, anticorps AI316788, anticorps AI414254, anticorps HRT1, anticorps Herp2, anticorps Hesr1, anticorps bHLHb31, anticorps hesr-1, anticorps id:ibd1292, anticorps zgc:110572, anticorps bc8, anticorps chf2, anticorps herp2, anticorps hesr1, anticorps hrt1, anticorps oaf1, anticorps xbc8, anticorps hes related family bHLH transcription factor with YRPW motif 1, anticorps hairy/enhancer-of-split related with YRPW motif 1, anticorps hes-related family bHLH transcription factor with YRPW motif 1, anticorps hes related family bHLH transcription factor with YRPW motif 1 S homeolog, anticorps HEY1, anticorps Hey1, anticorps hey1, anticorps hey1.S

Sujet: Hairy/enhancer of split-related proteins, such as HEY1, are basic helix-loop-helix (bHLH) transcription factors implicated in cell fate decision and boundary formation.

Poids moléculaire: 32 kDa (MW of target protein)

Pathways: Tube Formation