Matrilin 3 anticorps (Middle Region)
-
- Antigène Voir toutes Matrilin 3 (MATN3) Anticorps
- Matrilin 3 (MATN3)
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Matrilin 3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Matrilin 3 antibody was raised against the middle region of MATN3
- Purification
- Affinity purified
- Immunogène
- Matrilin 3 antibody was raised using the middle region of MATN3 corresponding to a region with amino acids IELYAVGVDRADMASLKMMASEPLEEHVFYVETYGVIEKLSSRFQETFCA
- Top Product
- Discover our top product MATN3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Matrilin 3 Blocking Peptide, catalog no. 33R-3946, is also available for use as a blocking control in assays to test for specificity of this Matrilin 3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MATN3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Matrilin 3 (MATN3)
- Autre désignation
- Matrilin 3 (MATN3 Produits)
- Synonymes
- anticorps DIPOA, anticorps EDM5, anticorps HOA, anticorps OADIP, anticorps OS2, anticorps AV009181, anticorps matrilin 3, anticorps MATN3, anticorps Matn3
- Sujet
- This gene encodes a member of von Willebrand factor A domain containing protein family. This family of proteins is thought to be involved in the formation of filamentous networks in the extracellular matrices of various tissues.
- Poids moléculaire
- 50 kDa (MW of target protein)
-