Matrilin 3 anticorps (Middle Region)

N° du produit ABIN633908

L’anticorps anti-Matrilin 3 Polyclonal Lapin est utilisé pour la détection de Matrilin 3 dans des échantillons de Humain et Souris. Il a été validé pour WB.

Aperçu rapide pour Matrilin 3 anticorps (Middle Region) (ABIN633908)

Antigène: Matrilin 3 (MATN3)

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Matrilin 3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Matrilin 3 anticorps

Épitope: Middle Region

Specificité: Matrilin 3 antibody was raised against the middle region of MATN3

Purification: Affinity purified

Immunogène: Matrilin 3 antibody was raised using the middle region of MATN3 corresponding to a region with amino acids IELYAVGVDRADMASLKMMASEPLEEHVFYVETYGVIEKLSSRFQETFCA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Matrilin 3 Blocking Peptide, (ABIN939332), is also available for use as a blocking control in assays to test for specificity of this Matrilin 3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MATN3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Matrilin 3

Antigène: Matrilin 3 (MATN3)

Autre désignation: Matrilin 3

Sujet: This gene encodes a member of von Willebrand factor A domain containing protein family. This family of proteins is thought to be involved in the formation of filamentous networks in the extracellular matrices of various tissues.

Poids moléculaire: 50 kDa (MW of target protein)