ART5 anticorps (Middle Region)

N° du produit ABIN633917

Détail du produit anti-ART5 anticorps

Antigène: ART5 (ADP-Ribosyltransferase 5 (ART5))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ART5 est non-conjugé

Application: Western Blotting (WB)

Specificité: ART5 antibody was raised against the middle region of ART5

Purification: Affinity purified

Immunogène: ART5 antibody was raised using the middle region of ART5 corresponding to a region with amino acids VFPKEREVLIPPHEVFLVTRFSQDGAQSLVTLWSYNQTCSHFNCAYLGGE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ART5 Blocking Peptide, catalog no. 33R-9536, is also available for use as a blocking control in assays to test for specificity of this ART5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ART5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ART5

Antigène: ART5 (ADP-Ribosyltransferase 5 (ART5))

Autre désignation: ART5 (ART5 Produits)

Synonymes: anticorps ARTC5, anticorps Yac-2, anticorps ART5, anticorps Art5, anticorps art5, anticorps ADP-ribosyltransferase 5, anticorps ecto-ADP-ribosyltransferase 5-like, anticorps ecto-ADP-ribosyltransferase 5, anticorps ADP-ribosyltransferase 5 L homeolog, anticorps ART5, anticorps Art5, anticorps LOC618664, anticorps LOC100715378, anticorps art5.L

Sujet: The protein encoded by this gene belongs to the ARG-specific ADP-ribosyltransferase family. Proteins in this family regulate the function of target proteins by attaching ADP-ribose to specific amino acid residues in their target proteins. The mouse homolog lacks a glycosylphosphatidylinositol-anchor signal sequence and is predicted to be a secretory enzyme. Transcript variants with different 5' UTRs, but encoding the same protein have been found for this gene.

Poids moléculaire: 30 kDa (MW of target protein)