CHI3L1 anticorps

N° du produit ABIN633931

Détail du produit anti-CHI3L1 anticorps

Antigène: CHI3L1 (Chitinase 3-Like 1 (Cartilage Glycoprotein-39) (CHI3L1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CHI3L1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: CHI3 L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LDFISIMTYDFHGAWRGTTGHHSPLFRGQEDASPDRFSNTDYAVGYMLRL

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CHI3L1 Blocking Peptide, catalog no. 33R-4844, is also available for use as a blocking control in assays to test for specificity of this CHI3L1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHI0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CHI3L1

Antigène: CHI3L1 (Chitinase 3-Like 1 (Cartilage Glycoprotein-39) (CHI3L1))

Autre désignation: CHI3L1 (CHI3L1 Produits)

Synonymes: anticorps AW208766, anticorps Brp39, anticorps Gp39, anticorps ASRT7, anticorps CGP-39, anticorps GP-39, anticorps GP39, anticorps HC-gp39, anticorps HCGP-3P, anticorps YKL-40, anticorps YKL40, anticorps YYL-40, anticorps hCGP-39, anticorps GP38K, anticorps CLP-1, anticorps SPC-40, anticorps SPS-40, anticorps Chil1, anticorps BP40, anticorps MGP-40, anticorps chitinase-like 1, anticorps chitinase 3 like 1, anticorps chitinase 3-like 1 (cartilage glycoprotein-39), anticorps Chil1, anticorps CHI3L1, anticorps Chi3l1

Classe de substances: Viral Protein

Sujet: CHI3L1 may play an important role in the capacity of cells to respond to and cope with changes in their environment. CHI3L1 may play a role in tissue remodeling and defense against pathogens. It belongs to the glycosyl hydrolase 18 family. CHI3L1 may play an important role in the capacity of cells to respond to and cope with changes in their environment.

Poids moléculaire: 42 kDa (MW of target protein)