B3GALNT2 anticorps (Middle Region)
-
- Antigène Voir toutes B3GALNT2 Anticorps
- B3GALNT2 (beta-1,3-N-Acetylgalactosaminyl Transferase 2 (B3GALNT2))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp B3GALNT2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- B3 GALNT2 antibody was raised against the middle region of B3 ALNT2
- Purification
- Affinity purified
- Immunogène
- B3 GALNT2 antibody was raised using the middle region of B3 ALNT2 corresponding to a region with amino acids PESFEGTIVWESQDLHGLVSRNLHKVTVNDGGGVLRVITAGEGALPHEFL
- Top Product
- Discover our top product B3GALNT2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
B3GALNT2 Blocking Peptide, catalog no. 33R-7062, is also available for use as a blocking control in assays to test for specificity of this B3GALNT2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of B0 ALNT2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- B3GALNT2 (beta-1,3-N-Acetylgalactosaminyl Transferase 2 (B3GALNT2))
- Autre désignation
- B3GALNT2 (B3GALNT2 Produits)
- Synonymes
- anticorps B3GalNAc-T2, anticorps MDDGA11, anticorps RGD1306946, anticorps zgc:112351, anticorps A930105D20Rik, anticorps C80633, anticorps D230016N13Rik, anticorps beta-1,3-N-acetylgalactosaminyltransferase 2, anticorps beta-1,3-N-acetylgalactosaminyltransferase 2 L homeolog, anticorps UDP-GalNAc:betaGlcNAc beta 1,3-galactosaminyltransferase, polypeptide 2, anticorps B3GALNT2, anticorps b3galnt2, anticorps B3galnt2, anticorps b3galnt2.L
- Sujet
- B3GALNT2 is the beta-1,3-N-acetylgalactosaminyltransferase active in synthesizing a unique carbohydrate structure, GalNAc-beta-1-3GlcNAc, on N- and O-glycans. B3GALNT2 has no galactose nor galactosaminyl transferase activity toward any acceptor substrate.
- Poids moléculaire
- 57 kDa (MW of target protein)
-