B3GALNT2 anticorps (Middle Region)

N° du produit ABIN633947

L’anticorps anti-B3GALNT2 Polyclonal Lapin est utilisé pour la détection de B3GALNT2 dans des échantillons de Humain et Souris. Il a été validé pour WB.

Aperçu rapide pour B3GALNT2 anticorps (Middle Region) (ABIN633947)

Antigène: B3GALNT2 (beta-1,3-N-Acetylgalactosaminyl Transferase 2 (B3GALNT2))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp B3GALNT2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-B3GALNT2 anticorps

Épitope: Middle Region

Specificité: B3 GALNT2 antibody was raised against the middle region of B3 ALNT2

Purification: Affinity purified

Immunogène: B3 GALNT2 antibody was raised using the middle region of B3 ALNT2 corresponding to a region with amino acids PESFEGTIVWESQDLHGLVSRNLHKVTVNDGGGVLRVITAGEGALPHEFL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

B3GALNT2 Blocking Peptide, (ABIN5612254), is also available for use as a blocking control in assays to test for specificity of this B3GALNT2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of B0 ALNT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur B3GALNT2

Antigène: B3GALNT2 (beta-1,3-N-Acetylgalactosaminyl Transferase 2 (B3GALNT2))

Autre désignation: B3GALNT2

Sujet: B3GALNT2 is the beta-1,3-N-acetylgalactosaminyltransferase active in synthesizing a unique carbohydrate structure, GalNAc-beta-1-3GlcNAc, on N- and O-glycans. B3GALNT2 has no galactose nor galactosaminyl transferase activity toward any acceptor substrate.

Poids moléculaire: 57 kDa (MW of target protein)