PYCR1 anticorps (Middle Region)

N° du produit ABIN633951

Détail du produit anti-PYCR1 anticorps

Antigène: PYCR1 (Pyrroline-5-Carboxylate Reductase 1 (PYCR1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PYCR1 est non-conjugé

Application: Western Blotting (WB)

Specificité: PYCR1 antibody was raised against the middle region of PYCR1

Purification: Affinity purified

Immunogène: PYCR1 antibody was raised using the middle region of PYCR1 corresponding to a region with amino acids RSLLINAVEASCIRTRELQSMADQEQVSPAAIKKTILDKDHLPLELGSPE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PYCR1 Blocking Peptide, catalog no. 33R-8196, is also available for use as a blocking control in assays to test for specificity of this PYCR1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PYCR1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PYCR1

Antigène: PYCR1 (Pyrroline-5-Carboxylate Reductase 1 (PYCR1))

Autre désignation: PYCR1 (PYCR1 Produits)

Synonymes: anticorps arcl2b, anticorps p5c, anticorps p5cr, anticorps pig45, anticorps pp222, anticorps pro3, anticorps pycr, anticorps ARCL2B, anticorps ARCL3B, anticorps P5C, anticorps P5CR, anticorps PIG45, anticorps PP222, anticorps PRO3, anticorps PYCR, anticorps zgc:73112, anticorps pyrroline-5-carboxylate reductase family, member 1 L homeolog, anticorps pyrroline-5-carboxylate reductase 1, anticorps pyrroline-5-carboxylate reductase 1a, anticorps pycr1.L, anticorps PYCR1, anticorps Pycr1, anticorps pycr1a

Sujet: This gene encodes an enzyme that catalyzes the NAD(P)H-dependent conversion of pyrroline-5-carboxylate to proline. This enzyme may also play a physiologic role in the generation of NADP(+) in some cell types.

Poids moléculaire: 33 kDa (MW of target protein)