PAPPA2 anticorps (Middle Region)
-
- Antigène Voir toutes PAPPA2 Anticorps
- PAPPA2 (Pappalysin 2 (PAPPA2))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PAPPA2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PAPPA2 antibody was raised against the middle region of PAPPA2
- Purification
- Affinity purified
- Immunogène
- PAPPA2 antibody was raised using the middle region of PAPPA2 corresponding to a region with amino acids ALPQSHFQHSSQHSSGEEEATDLVLTASFEPVNTEWVPFRDEKYPRLEVL
- Top Product
- Discover our top product PAPPA2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PAPPA2 Blocking Peptide, catalog no. 33R-1360, is also available for use as a blocking control in assays to test for specificity of this PAPPA2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAPPA2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PAPPA2 (Pappalysin 2 (PAPPA2))
- Autre désignation
- PAPPA2 (PAPPA2 Produits)
- Synonymes
- anticorps PAPP-A2, anticorps PLAC3, anticorps Pappe, anticorps PAPP-E, anticorps PAPPE, anticorps si:dkey-39f8.1, anticorps pappalysin 2, anticorps Pappa2, anticorps PAPPA2, anticorps pappa2
- Sujet
- PAPPA2 is a metalloproteinase which specifically cleaves IGFBP-5. It shows limited proteolysis toward IGFBP-3.
- Poids moléculaire
- 92 kDa (MW of target protein)
-